PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G293300.1.p
Common NameGLYMA_08G293300, MYB149
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 207aa    MW: 23205.4 Da    PI: 10.3283
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G293300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-1370114347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ l++ + +  G+g+W+ I+r + k+Rt+ q+ s+ qky
  Glyma.08G293300.1.p  70 PWTEEEHRLFLLGLQNIGKGDWRGISRNFVKTRTPTQVASHAQKY 114
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.96463119IPR017930Myb domain
SuperFamilySSF466896.13E-1765118IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-1766117IPR006447Myb domain, plants
SMARTSM007175.8E-967117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-1169114IPR009057Homeodomain-like
CDDcd001671.56E-870115No hitNo description
PfamPF002491.2E-1070114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MCSAEKDGIM LFGVRLSVVD NHPTSFRKSA SMTNLSQYES PPPHDPNAGY ASDDVVHPSR  60
HTRERKRGVP WTEEEHRLFL LGLQNIGKGD WRGISRNFVK TRTPTQVASH AQKYFLRRHT  120
QNRRRRRSSL FDITTDSVME PWPEKEEEQV VLPSARSKPV LPVPPSSKMA ELDLSGKSLS  180
LKLPVSKPPI SNENFGGIPL SVLLEG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.231790.0leaf| pod
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0919340.0BT091934.1 Soybean clone JCVI-FLGm-9M5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236463.11e-151MYB transcription factor MYB149
SwissprotQ2V9B04e-46MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLQ0PJB31e-151Q0PJB3_SOYBN; MYB transcription factor MYB149
STRINGGLYMA08G40460.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-57MYB_related family protein